General Information

  • ID:  hor000987
  • Uniprot ID:  P41520
  • Protein name:  Cholecystokinin
  • Gene name:  CCK
  • Organism:  Bos taurus (Bovine)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0032094 response to food; GO:0042755 eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon

Sequence Information

  • Sequence:  QPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS
  • Length:  95(21-115)
  • Propeptide:  MNRGVCLCLLMAVLAAGALAQPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS
  • Signal peptide:  MNRGVCLCLLMAVLAAGALA
  • Modification:  T77 Sulfotyrosine;T83 Phenylalanine amide;T93 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR, CCKAR
  • Target Unid:   P79266, A6QLH2
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41520-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000987_AF2.pdbhor000987_ESM.pdb

Physical Information

Mass: 1253901 Formula: C466H742N150O143S4
Absent amino acids: C Common amino acids: R
pI: 9.73 Basic residues: 17
Polar residues: 18 Hydrophobic residues: 26
Hydrophobicity: -101.05 Boman Index: -29790
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 57.68
Instability Index: 6906.74 Extinction Coefficient cystines: 9970
Absorbance 280nm: 106.06

Literature

  • PubMed ID:  NA
  • Title:  NA